PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.011440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 211aa    MW: 24425.2 Da    PI: 4.9945
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.011440.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-161764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd  l ++++ +G g W++ a+  g++Rt+k+c++rw++yl
   Cucsa.011440.1 17 KGPWTMEEDSMLMNYIANHGEGVWNSLAKAAGLKRTGKSCRLRWLNYL 64
                     79********************************************97 PP

2Myb_DNA-binding55.41.4e-1770113146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+ +++ ++G++ W++Iar+++ gRt++++k++w++
   Cucsa.011440.1  70 RGNITPEEQLLIMELHSKWGNR-WSKIARHLP-GRTDNEIKNYWRT 113
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-231067IPR009057Homeodomain-like
PROSITE profilePS5129415.3821264IPR017930Myb domain
SuperFamilySSF466892.11E-3015111IPR009057Homeodomain-like
SMARTSM007171.7E-111666IPR001005SANT/Myb domain
PfamPF002493.5E-151764IPR001005SANT/Myb domain
CDDcd001671.29E-81964No hitNo description
PROSITE profilePS5129425.53565119IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2468119IPR009057Homeodomain-like
SMARTSM007173.8E-1569117IPR001005SANT/Myb domain
PfamPF002496.5E-1670113IPR001005SANT/Myb domain
CDDcd001671.84E-1174113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MGTERLSSSQ DDDEVRKGPW TMEEDSMLMN YIANHGEGVW NSLAKAAGLK RTGKSCRLRW  60
LNYLRPDVRR GNITPEEQLL IMELHSKWGN RWSKIARHLP GRTDNEIKNY WRTRIQKHIK  120
QQEEVERVRD QMISIGSCSE TNDDCAISPW SQVSSFSNVA EPMEISHDYF PSSQGDMEAM  180
GYQQTSWDRG DGANDNYWSM EDLWSMQLLD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211922128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818901e-174LN681890.1 Cucumis melo genomic scaffold, anchoredscaffold00048.
GenBankLN7132631e-174LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011655413.11e-157PREDICTED: myb-related protein 340-like
SwissprotP813911e-79MYB05_ANTMA; Myb-related protein 305
TrEMBLQ0PJJ68e-89Q0PJJ6_SOYBN; MYB transcription factor MYB181
STRINGGLYMA16G07960.12e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.16e-79myb domain protein 21